Last night I attended a wonderful Circle on the topic of Akashic Records. Akashic Records keep the events of every Soul’s journey through each incarnation of their life. Basically, it is our book of life – not just this life but all previous lives as well as all future lives. A part of the discussion was how we cleanse (not erase) our records so we are not burdened, or held back, by our physical, mental, and emotional pains from previous and future lives.
For many of us, I’d guess all of us, we have had either physical pains (knees, hips, shoulders, internal, etc.), mental pains (depression, bipolar, anxiety, etc), and/or emotional pains (abusive relationships, addictions, etc) that we deal with on either a daily basis or with some regularity. For those who see Spirit in all things, we believe that these pains are issues/lessons that we haven’t completely dealt with. Going through our Akashic Records to cleanse them, means that we allow those lessons to be completed. (I’d like to add here that there are certain lessons of this lifetime that we are meant to learn, so if we are blind or disabled in any way, we won’t just start seeing or step out of our wheelchair, for example. That IS why we take on our human form, to learn more from the school of Earth! Another disclaimer here, though: God works in mysterious ways, and miracles do occur, and so we should never think we are “stuck” with any pain. Do we think we are deserving of a miracle? In God, all things are possible.)
However, residue from previous lives slip into this life, and these are the ones that we can cleanse.
How do we cleanse our Akashic Records? We ask for the assistance of our angels and guides who teach us and help us on our journey on earth. Metatron is the Archangel who keeps the records, and so we ask Metatron for access to our records. From there, we can ask for lessons to be revealed and then ask for them to be cleansed. Our personal angels and guides can assist with that.
Last night, we were advised to set some intentions before going to bed. So before I fell asleep, I asked that my dreamworld reveal the lesson I am to be learning right now.
Here is the dream that I remember: My younger son and I are looking out the windows of my yoga studio, and there are many birds on the ground. In the midst of these birds, we spot what I think is a young eagle, yet it is too big to be so young. But in my dream, I tell my son, look, there is an eagle, and it’s walking toward us! And then we see another one, and another one, and another; five in all! And they walk in a line toward us. They are big and gray with black beaks. (This is how I know they are not eagle, but I wanted them to be eagle because I love eagle!) They are not very pretty either. They don’t have a message for us, but we both know they are there for a reason.
Upon waking this morning, I am thinking, did I have a significant dream last night? And then I recall the five “eagles.” But already my mind says, Jill, they are not eagles, they are vultures. So then I think, maybe they are condors? Condors are different looking than eagles, and they are majestic and admired too! But of course, there is that little voice in my head, saying, go look up eagle and condor… and then look up vulture.
So I do. Not one picture of eagle looks like the birds that came to me. And then I look up condor. Nope, not him either. and then I look at vulture. Yep, there they are.
Poor vulture, has such a bad reputation! Even someone as open as me doesn’t want to be associated with vulture! so I looked up the medicine of vulture. The first line is: The Cherokee know the Vulture as ‘Peace Eagle’, for the Turkey Vulture Kills Nothing.
Peace Eagle? The irony does not escape me! 2011 has been the year of starting a Women for Peace initiative, which I hold dear to my Heart. It is still in the conceptual stages, but it is in my thoughts nearly every thinking moment, reading for manifestation.
So what else did I learn about vulture medicine?
The job the vulture performs is a sacred service for all animal life forms. The toxins, pathogens and diseases that are possible as animals decompose and rot is substantial. The vulture was designed to clean this up. And with this purpose it accomplishes the Creators will with honor and no complaints. The vulture does what needs to be done. It cleans up, protects, and is connected to the water as its protector. To some it is ugly, but upon the invisible air it rides the current defying gravity with beauty and grace. It teaches us that nasty jobs of service that need to get done are rewarded with great gifts.
The vulture is often looked down upon. However, the vulture in fact, looks down on you. The vulture sees all and knows what is done to the Earthly Mother.
The vulture mates for life, and lives in community upon a communal roost each night. This roost location varies each night. Each vulture ‘clan’ cleaning the territory as it sees fit. With communication that is transacted from many miles away, a vulture can see the flight patterns of its brethren, with eyesight ten times better than our own (not verified). A clan chieftan sends a signal that is relayed each evening, and a roost is selected. These roosts can be constant for many years and even generations. A system of roosts helps to ensure that the land is purified systematically. The roost is usually on a ridge that overlooks a river, and is normally in a spot that receives the last of the days sun, as well the first at sunrise. Each morning, the vulture clan turns to face the sacred sun. Warming the feathers together in union before heading to work.
Eye contact with a vulture is easy. Just look at them and they see you.
The Egyptian Goddess Maat holds a vulture feather. Anubis, the jackal headed God, weighs your heart against Matts feather of truth. The Goddess Maat is protector of the Earth and her eyes are the eyes of the vulture ~ these eyes see all that we do, and will some day bring justice. In Greek & Assyrian mythology, the (old world) vulture was believed to be descended from the griffin, the guardian of the mysteries of life & death. The Goddess Maat represents the ideals of law, order, and truth. The word, Maat translates “that which is straight.” it implies anything that is true, ordered, or balanced. She was the female counterpart of Thoth. We know she is a very ancient goddess because we find her in the boat of Ra as it rose above the waters of the abyss of Nu on the first day. Together with Thoth, they charted the daily course of the sun god Ra. She is sometimes called the ‘eye of Ra’ or the ‘daughter of Ra’.
http:/deepcreeklakefamilyactivities.com/vulture_medicine.htm
The scientific name for the Turkey Vulture is CATHARTES AURA which means GOLDEN PURIFIER because as it goes about it’s lifetime business it purifies the landscape and environment in it’s own natural way, ensuring the continued health and life of other living things. The Vulture is a promise that all hardship was temporary and necessary for a higher purpose. Once a Vulture enters your life as a totem or guide, it will remain with you for life.
Vultures live and work together, both in cooperation and friendliness. They communicate with friends and neighbors when they find something to eat. They let the others know where the food is. And when there is a big feast they communicate with neighboring flocks in distant roosts. http:/sped2work.tripod.com/totem.html
Hmm, lots of information for me, from vulture. If I read this from the perspective of running yoga classes and the women’s circles, the information about healing and protecting is very “right on.” Also the idea of community and cooperation. If I look at this from the perspective of my activism in politics, the idea of the “nasty jobs” getting done makes sense, as does the connection with the Goddess Maat, who seeks justice. The idea of eye contact: look at them, they see you; that is very true, as I am one who “sees” into a person’s Soul through their eyes.
More interesting for me is the number five, and that the vultures walked toward me in a line. My interpretation is that there will be (or has been) five events that will occur sequentially for me on this peace mission.
Today I will ponder the medicine of vulture in my life.
Peace!